Specifications

Variant Details
Catalog ID153398-10UGSupplier Catalog ID153398-10ug
Size10 µgPrice $ 343.00
Supplier United States Biological Inc. Package Content Aggrecan (AGC) Recombinant, Human, 10ug
General
Shipping TemperatureBlue IceStorage & Handling4°C/-70°C
Molecular Weight18.2Purity≥95%

Description

Source:
Recombinant Human from E. coli

Purity:
≥95%

Endotoxin:
1.0EU per 1ug (determined by the LAL method)

Accession No:
P16112

Fragment:
Pro34~Glu147 (Accession No: P16112)

Sequence:
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-PQPSPLR VLLGTSLTIP CYFIDPMHPV TTAPSTAPLA PRIKWSRVSK EKEVVLLVAT EGRVRVNSAY QDKVSLPNYP AIPSDATLEV QSLRSNDSGV YRCEVMHGIE DSEATLE

Epitope Tag:
N-terminal Tags: His-tag and S-tag

Molecular Weight:
18.2kD

Applications:
Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.
Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note:
Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

For research use only.