Specifications

Variant Details
Catalog ID153588-50UGSupplier Catalog ID153588
Size50 µgPrice $ 446.00
Supplier United States Biological Inc. Package Content Apolipoprotein M (APOM) Recombinant, Human, 50ug
General
Molecular Weight25.8Purity≥95%
Shipping TemperatureBlue IceStorage & Handling4°C/-70°C

Description

Source:
Recombinant Human from E. coli

Purity:
≥95%

Endotoxin:
1.0EU per 1ug (determined by the LAL method)

Accession No:
O95445

Fragment:
Ala8~Asn188 (Accession No: O95445)

Sequence:
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-ALL YFYGIILNSI YQCPEHSQLT TLGVDGKEFP EVHLGQWYFI AGAAPTKEEL ATFDPVDNIV FNMAAGSAPM QLHLRATIRM KDGLCVPRKW IYHLTEGSTD LRTEGRPDMK TELFSSSCPG GIMLNETGQG YQRFLLYNRS PHPPEKCVEE FKSLTSCLDS KAFLLTPRNQ EACELSNN

Epitope Tag:
N-terminal Tags: His-tag and S-tag

Molecular Weight:
25.8kD

Applications:
Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.
Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note:
Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

For research use only.