Brand
Abnova
Manufacturer
Abnova
Mfr. Catalog ID
H00053831-G01
Size (Packaging)
1 available
Supplier
9 available

Products purchased from the suppliers above are governed by the Suppliers' Terms, which include applicable warranties, return policies and other terms and policies. They are available via the Supplier Terms link next to each supplier's name.

Description
Full product descriptions are available for ZAGENO customers.
Get Started

MANUFACTURER CAT. ID H00053831-G01 Copy Catalog ID

Price on Request

Join ZAGENO's Marketplace

The largest life sciences lab supply marketplace.

  • 20 MILLION+ SKUs
  • 3,500+ SUPPLIERS
  • SCIENTIFIC EXPERTS AT YOUR SERVICE
Access ZAGENO Marketplace
Specifications
Package ContentsGPR84 Recombinant Protein
Protein NatureRecombinant
Gene ID53831
OrganismWheat germ
Formulation25mM Tris-HCl of pH8.0 containing 2% glycerol.
SequenceSequence MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
ApplicationsAntibody Production, In Vitro Assay (Functional Bioassay), Screening
Storage & HandlingStore at −80°C. Aliquot to avoid repeated freezing and thawing.
Resources
Certificate of Analysis (CoA)
1 available
GPR84 Recombinant Protein
https://www.novusbio.com/PDFs/H00053831-G01.pdf
Documentation
1 available
Documentation
http://www.abnova.com/PDFServer/outputs/H00053831-G01.pdf