Specifications

Variant Details
Catalog ID246902-PE-100ULSupplier Catalog ID246902-PE
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti- HAND2 (PE) mAb SKU:246902-PE, 100ul
General
ClonalityMonoclonalHostMouse
ApplicationsELISA, Western BlotClone No.1C7
ConjugatedConjugatedConjugate TypePE (Phycoerythrin)
IsotypeIgGImmunogenHAND2 (NP_068808.1, 135aa-216aa) partial recombinant protein with GST tag
GeneHAND2Protein Accession No.NP_068808.1
FormLiquidShipping TemperatureBlue Ice
Storage & Handling4°C. Do Not FreezeStorage BufferPBS, pH 7.2. No preservative added.
PurityPurified

Description

Mouse moThe protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq

Applications:
Suitable for use in ELISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.