Specifications

Variant Details
Catalog ID126869-AP-100ULSupplier Catalog ID126869-AP
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human CDHR3 (AP) mAb SKU:126869-AP, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western blotClone No.8E8
ConjugatedConjugatedConjugate TypeAP (Alkaline Phosphatase)
IsotypeIgGImmunogenPartial recombinant protein corresponding to aa776-886 from human FLJ23834 (NP_689963) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneCDHR3
Protein Accession No.NP_689963FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK

Storage and Stability:
Store product at 4°C. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.