Specifications

Variant Details
Catalog ID126258-ML750-100ULSupplier Catalog ID126258-ML750
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human EIF5B (MaxLight™750) mAb SKU:126258-ML750, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsFLISAClone No.3F9
ConjugatedConjugatedConjugate TypeMaxLight
Specific ConjugateMaxLight™750IsotypeIgG
ImmunogenPartial recombinant corresponding to aa1121-1218 from EIF5B (NP_056988) with GST tagPurification MethodPurified by Protein A affinity chromatography.
GeneEIF5BProtein Accession No.NP_056988
FormLiquidShipping TemperatureBlue Ice
Storage & Handling4°C. Do Not FreezeStorage BufferPBS, pH 7.2. No preservative added.
PurityAffinity Purified

Description

MaxLight™750 is a new Near IR stable dye conjugate comparable to DyLight™750, Alexa Fluor™700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.

Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.

Applications:
Suitable for use in FLISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.