Specifications

Variant Details
Catalog ID127091-AP-100ULSupplier Catalog ID127091-AP
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human GADD153 (AP) mAb SKU:127091-AP, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western BlotClone No.2G3
ConjugatedConjugatedConjugate TypeAP (Alkaline Phosphatase)
IsotypeIgGImmunogenPartial recombinant corresponding to aa1-90 from human DDIT3 (AAH03637) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneGADD153
Protein Accession No.BC003637, AAH03637FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

GADD 153 was described as a growth arrest and DNA damage inducible gene that encodes a C/EBP- related nuclear protein. GADD153 expression is induced by a variety of cellular stresses, including nutrient deprivation and metabolic perturbations. GADD153 functions to block cells in G1 to S phase in cell cycle progression and acts by dimerizing with other C/EBP proteins to direct GADD153 dimers away from "classical" C/EBP binding sites, recognizing unique "non-classical" sites instead.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL

Storage and Stability:
Store product at 4°C. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.