Specifications

Variant Details
Catalog ID129061-100UGSupplier Catalog ID129061
Size100 µgPrice $ 539.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human LEP mAb SKU:129061, 100ug
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western BlotClone No.3G1-1C9
IsotypeIgGImmunogenFull length recombinant corresponding to aa22-167 from human LEP (AAH60830.1) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneLEP
Protein Accession No.BC060830, AAH60830.1FormLiquid
Shipping TemperatureBlue IceStorage & Handling-20°C
Storage BufferPBS, pH 7.2.PurityAffinity Purified

Description

May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

For research use only.