Specifications

Variant Details
Catalog ID248820-200ULSupplier Catalog ID248820
Size200 µlPrice $ 539.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human MMP26 mAb SKU:248820, 200ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western BlotClone No.3B9
IsotypeIgGImmunogenMMP26 (NP_068573, 152aa-261aa) partial recombinant protein with GST tag
GeneMMP26Protein Accession No.NP_068573
FormLiquidShipping TemperatureBlue Ice
Storage & Handling-20°CPurityAscites

Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. [provided by RefSeq

Applications:
Suitable for use in ELISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

For research use only.