Specifications

Variant Details
Catalog ID130844-100UGSupplier Catalog ID130844
Size100 µgPrice $ 539.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human PAK2 mAb SKU:130844, 100ug
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western BlotClone No.1E1
IsotypeIgGImmunogenPartial recombinant corresponding to aa131-230 from human PAK2 (NP_002568) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GenePAK2
UniProtKBQ13177GenBank Accession No.NM_002577
FormLiquidShipping TemperatureBlue Ice
Storage & Handling-20°CStorage BufferPBS, pH 7.2.
PurityAffinity Purified

Description

The PAK (p21-activated kinase) family of serine/threonine kinases plays an important role in multiple cellular processes, including cytoskeletal reorganization, MAPK signaling, apoptotic signaling, etc. Binding of Rac/cdc42 to the CRIB (or PBD) domain at the N-terminal region of PAK causes autophosphorylation and conformational change of PAK. Phosphorylation of Ser21 of PAK1 or Ser20 of PAK2 regulates its binding with the adaptor protein Nck.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDE

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

For research use only.