Specifications

Variant Details
Catalog ID131564-200ULSupplier Catalog ID131564
Size200 µlPrice $ 539.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human POLD4 mAb SKU:131564, 200ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western BlotClone No.2B11
IsotypeIgGImmunogenFull length recombinant corresponding to aa1-35 from human POLD4 (AAH01334) with GST tag
GenePOLD4Protein Accession No.BC001334, AAH01334
FormLiquidShipping TemperatureBlue Ice
Storage & Handling-20°CPurityAscites

Description

Required for optimal DNA polymerase delta activity. May contribute to PCNA-dependent activity of DNA polymerase delta.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

For research use only.