Specifications

Variant Details
Catalog ID131755-PE-100ULSupplier Catalog ID131755-PE
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human PRDX4 (PE) mAb SKU:131755-PE, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Immunohistochemistry, Western BlotClone No.2C12
ConjugatedConjugatedConjugate TypePE (Phycoerythrin)
IsotypeIgGImmunogenPartial recombinant corresponding to aa51-150 from PRDX4 with GST tag
Purification MethodPurified by Protein A affinity chromatography.GenePRDX4
FormLiquidShipping TemperatureBlue Ice
Storage & Handling4°C. Do Not FreezeStorage BufferPBS, pH 7.2. No preservative added.
PurityAffinity Purified

Description

Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.

Applications:
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.