Specifications

Variant Details
Catalog ID133427-APC-100ULSupplier Catalog ID133427-APC
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human SLC22A6 (APC) mAb SKU:133427-APC, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman, Monkey
ApplicationsELISA, Immunohistochemistry, Western BlotClone No.1F2
ConjugatedConjugatedConjugate TypeAPC (Allophycocyanin)
IsotypeIgGImmunogenPartial recombinant corresponding to aa451-550 from SLC22A6 (AAH33682) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneSLC22A6
Protein Accession No.BC033682FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

Applications:
Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
TMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.