Specifications

Variant Details
Catalog ID135171-AP-100ULSupplier Catalog ID135171-AP
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human USP33 (AP) mAb SKU:135171-AP, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Immunohistochemistry, Immunoprecipitation, Western blotClone No.5B5
ConjugatedConjugatedConjugate TypeAP (Alkaline Phosphatase)
IsotypeIgGImmunogenPartial recombinant corresponding to aa327-427 from USP33 (NP_055832) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneUSP33
Protein Accession No.NP_055832FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

Applications:
Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
20ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
SDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQIL*

Storage and Stability:
Store product at 4°C. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.