Specifications

Variant Details
Catalog ID135172-FITC-100ULSupplier Catalog ID135172-FITC
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti-Human USP34 (FITC) mAb SKU:135172-FITC, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Immunofluorescence, Immunohistochemistry, Western BlotClone No.2E2
ConjugatedConjugatedConjugate TypeFITC (Fluorescein isothiocyanate)
IsotypeIgGImmunogenPartial recombinant corresponding to aa3296-3395 from USP34 (NP_055524) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneUSP34
Protein Accession No.NP_055524FormLiquid
Shipping TemperatureBlue IceStorage & Handling-20°C
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

Applications:
Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.