Specifications

Variant Details
Catalog ID248563-ML490-100ULSupplier Catalog ID248563-ML490
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti- MAZ (MaxLight™490) mAb SKU:248563-ML490, 100ul
General
ClonalityMonoclonalHostMouse
ApplicationsFLISA, Western BlotClone No.6G2
ConjugatedConjugatedConjugate TypeMaxLight
Specific ConjugateMaxLight™490IsotypeIgG
ImmunogenMAZ (NP_002374, 332aa-440aa) partial recombinant protein with GST tagGeneMAZ
Protein Accession No.NP_002374FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityPurified

Description

MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.

Mouse monoclonal antibody raised against a partial recombinant MAZ.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.