Specifications

Variant Details
Catalog ID248974-PE-100ULSupplier Catalog ID248974-PE
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti- MSX1 (PE) mAb SKU:248974-PE, 100ul
General
ClonalityMonoclonalHostMouse
Applicable ProcessesELISA, ImmunoprecipitationClone No.2B12
ConjugatedConjugatedConjugate TypePE (Phycoerythrin)
IsotypeIgGImmunogenMSX1 (NP_002439, 216aa-297aa) full length recombinant protein with GST tag
GeneMSX1Protein Accession No.NP_002439
FormLiquidShipping TemperatureBlue Ice
Storage & Handling4°C. Do Not FreezeStorage BufferPBS, pH 7.2. No preservative added.
PurityPurified

Description

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq

Applications:
Suitable for use in ELISA, Immunoprecipitation. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVMouse monoclonal antibody raised against a full length recombinant MSX1.AGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.