Specifications

Variant Details
Catalog ID251477-APC-100ULSupplier Catalog ID251477-APC
Size100 µlPrice $ 681.00
Supplier United States Biological Inc. Package Content Mouse Anti- SEC22B (APC) mAb SKU:251477-APC, 100ul
General
ClonalityMonoclonalHostMouse
ApplicationsELISA, Western BlotClone No.5A10
ConjugatedConjugatedConjugate TypeAPC (Allophycocyanin)
IsotypeIgGImmunogenSEC22B (NP_004883, 1aa-110aa) partial recombinant protein with GST tag
GeneSEC22BProtein Accession No.NP_004883
FormLiquidShipping TemperatureBlue Ice
Storage & Handling4°C. Do Not FreezeStorage BufferPBS, pH 7.2. No preservative added.
PurityPurified

Description

The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins

Applications:
Suitable for use in ELISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.