Specifications

Variant Details
Catalog IDNBP1-92186Supplier Catalog IDNBP1-92186
Size0.1 mlPrice N/A
Supplier N/A Package Content NLRP11 Antibody SKU: NBP1-92186, Each: 0.1mL
General
AntigenNLRP11ClonalityPolyclonal
HostRabbitReactivityHuman
ApplicationsImmunohistochemistry, Western BlotConjugatedUnconjugated
IsotypeIgGImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:HLGNDGVAKLLESLISPDCVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASR
FormulationPhospate buffered saline, pH 7.2, containing 40% glycerolGene ID204801
Shipping Condition/Storage & HandlingStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Description

Currently, no description is available.

For research use only.

Resources

Handbook

NLRP11 Antibody SKU: NBP1-92186

Article

Protocol

Brochure

Handbook

NLRP11 Antibody SKU: NBP1-92186

Publication

Validation