Specifications

Variant Details
Catalog IDNBP1-88525Supplier Catalog IDNBP1-88525
Size100 µlPrice N/A
Supplier N/A Package Content PPAN Antibody SKU: NBP1-88525, Each: 0.1mL
General
AntigenPPANClonalityPolyclonal
HostRabbitReactivityHuman
ApplicationsImmunocytochemistry, Immunofluorescence, Immunohistochemistry, Western BlotConjugatedUnconjugated
IsotypeIgGImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG
FormulationPBS, pH 7.2, containing 40% glycerolGenepeter pan homolog (PPAN, Homo sapiens)
Gene ID56342 (Homo sapiens)Alternative Names & SynonymsSSF,SSF1,SSF2,BXDC3,SSF-1 (Homo sapiens)
Shipping Condition/Storage & HandlingStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Description

Currently, no description is available.

For research use only.

Resources

Handbook

PPAN Antibody SKU: NBP1-88525

Article

Protocol

Brochure

Handbook

PPAN Antibody SKU: NBP1-88525

Publication

Validation