
Variant Details
Catalog ID350780-100UGSupplier Catalog ID350780
Size100 µgPrice $ 450.00
Supplier United States Biological Inc. Package Content Rabbit Anti-human Pea3, NT polyclonal antibody SKU:350780, 100 µg
ReactivityHumanCross ReactivityHuman, Rat
ApplicationsWestern BlotConjugatedUnconjugated
IsotypeIgGImmunogenSynthetic peptide corresponding to aa1-41, MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLG- KLM, of human Pea3 at N-terminal.
SpecificityRecognizes human Pea3.DilutionWestern Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Purification MethodPurified by immunoaffinity chromatography.GenePea3, NT
Shipping TemperatureBlue IceStorage & Handling-20°C
PurityAffinity Purified


ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.Applications: Suitable for use in Western Blot. Other applications not tested.Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

For research use only.