Specifications

Variant Details
Catalog ID138378-100UGSupplier Catalog ID138378
Size100 µgPrice $ 579.00
Supplier United States Biological Inc. Package Content Rabbit Anti-human SLC43A3 polyclonal antibody SKU:138378, 100 µg
General
ClonalityPolyclonalHostRabbit
ReactivityHumanCross ReactivityHuman
Applicable ProcessesImmunocytochemistry, Western blotConjugatedUnconjugated
IsotypeIgGImmunogenN-terminus of SLC43A3 corresponding to MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD
SpecificityRecognizes human SLC43A3.DilutionWestern Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher.
Purification MethodPurified by Protein A affinity chromatography.GeneSLC43A3
FormLyophilizedShipping TemperatureBlue Ice
Storage & Handling-20°CPurityAffinity Purified

Description

SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.Applications:Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.Recommended Dilution:Western Blot: 2.5ug/mlImmunohistochemistry: 4-8ug/mlOptimal dilutions to be determined by the researcher.Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

For research use only.