
Variant Details
Catalog ID303632-100UGSupplier Catalog ID303632
Size100 µgPrice $ 450.00
Supplier United States Biological Inc. Package Content Rabbit Anti-human SOX5, CT polyclonal antibody SKU:303632, 100 µg
ReactivityHumanCross ReactivityHuman, Rat
ApplicationsWestern BlotConjugatedUnconjugated
IsotypeIgGImmunogenSynthetic peptide corresponding to aa495-528, EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS, from human SOX5 at C-terminus, different from the related mouse sequence by 2aa.
SpecificityRecognizes human SOX5.DilutionWestern Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Purification MethodPurified by immunoaffinity chromatography.GeneSOX5, CT
Shipping TemperatureBlue IceStorage & Handling-20°C
PurityAffinity Purified


Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.Applications: Suitable for use in Western Blot. Other applications not tested.Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

For research use only.