Specifications

Variant Details
Catalog ID138440-100UGSupplier Catalog ID138440
Size100 µgPrice $ 579.00
Supplier United States Biological Inc. Package Content Rabbit Anti-human TMED4 polyclonal antibody SKU:138440, 100 µg
General
ClonalityPolyclonalHostRabbit
ReactivityHumanCross ReactivityHuman
ApplicationsImmunocytochemistry, Western blotConjugatedUnconjugated
IsotypeIgGImmunogenN-terminus of TMED4 corresponding to LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
SpecificityRecognizes human TMED4.DilutionWestern Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher.
Purification MethodPurified by Protein A affinity chromatography.GeneTMED4
FormLyophilizedShipping TemperatureBlue Ice
Storage & Handling-20°CPurityAffinity Purified

Description

TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.Applications:Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.Recommended Dilution:Western Blot: 1.25ug/mlImmunohistochemistry: 4-8ug/mlOptimal dilutions to be determined by the researcher.Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

For research use only.