Specifications

Variant Details
Catalog IDNBP1-90344Supplier Catalog IDNBP1-90344
Size1 PackPrice N/A
Supplier N/A Package Content Synaptobrevin homolog YKT6 Antibody
General
AntigenSynaptobrevin homolog YKT6ClonalityPolyclonal
HostRabbitReactivityHuman
ApplicationsImmunocytochemistry, Immunofluorescence, Immunohistochemistry, Western BlotConjugatedUnconjugated
IsotypeIgGImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:NPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM
FormulationPBS, pH 7.2, containing 40% glycerolGene ID10652.0
Shipping Condition/

Description

Currently, no description is available.

For research use only.

Resources

Handbook

Synaptobrevin homolog YKT6 Antibody SKU: NBP1-90344

Article

Protocol

Brochure

Handbook

Synaptobrevin homolog YKT6 Antibody SKU: NBP1-90344

Publication

Validation